PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof002821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HD-ZIP
Protein Properties Length: 274aa    MW: 29986.9 Da    PI: 4.5366
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-42626PU_refplantGDBView CDS
PUT-157a-Saccharum_officinarum-42624PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.3e-2078131356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++t+eq++ Le+ Fe+++++  e+++eLA++lg+  rqV vWFqNrRa++k
  Sof002821  78 KKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWK 131
                56789************************************************9 PP

2HD-ZIP_I/II133.48.1e-4377168192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl++eqv+lLE+sFeee+kLeperK+elar+Lg+ prqvavWFqnrRAR+ktkqlE+dy++Lk+aydal+++++ L +++++Lr+++ 
    Sof002821  77 EKKRRLTAEQVQLLERSFEEENKLEPERKTELARRLGMAPRQVAVWFQNRRARWKTKQLETDYDHLKAAYDALAADHQGLLADNDSLRAQVV 168
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.6E-1972136IPR009057Homeodomain-like
PROSITE profilePS5007118.20473133IPR001356Homeobox domain
SMARTSM003896.9E-1976137IPR001356Homeobox domain
CDDcd000862.80E-1878134No hitNo description
PfamPF000463.9E-1778131IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-2179140IPR009057Homeodomain-like
PRINTSPR000314.4E-6104113IPR000047Helix-turn-helix motif
PROSITE patternPS000270108131IPR017970Homeobox, conserved site
PRINTSPR000314.4E-6113129IPR000047Helix-turn-helix motif
PfamPF021831.5E-16133175IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MDPSAVSFNS GGARRGGGGA QMLLFGGGGS ANSNGFFRGV PMAVLGMDDA TRVGKRPFFT  60
THEELLEEEY YDEQAPEKKR RLTAEQVQLL ERSFEEENKL EPERKTELAR RLGMAPRQVA  120
VWFQNRRARW KTKQLETDYD HLKAAYDALA ADHQGLLADN DSLRAQVVSL TEKLQGKETS  180
PSATTAAQEV DQPDEHTAAS GTEKLLAQQL KDDLHSSGDC TGHGALSSEE EDGGVVSDEG  240
SFDLPDAMFA AGVTHHGADA EEAQLANWTS WFWN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125133RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.141780.0bud| callus| crown| inflorescence| leaf| meristem| root| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001148520.11e-165homeodomain leucine zipper protein CPHB-5
SwissprotQ6ZA741e-116HOX5_ORYSJ; Homeobox-leucine zipper protein HOX5
TrEMBLB4FLB11e-173B4FLB1_MAIZE; HB transcription factor
STRINGGRMZM2G122076_P011e-164(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-54homeobox 1